Lineage for d5th1c_ (5th1 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776662Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries)
  8. 2776685Domain d5th1c_: 5th1 C: [332728]
    Other proteins in same PDB: d5th1b_, d5th1d_, d5th1f_
    automated match to d4d00c_
    complexed with nag; mutant

Details for d5th1c_

PDB Entry: 5th1 (more details), 2.19 Å

PDB Description: crystal structure of h10 hemagglutinin mutant (k158aa-q226l-g228s) from jiangxi-donghu (2013) h10n8 influenza virus in complex with 6'- slnln
PDB Compounds: (C:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d5th1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5th1c_ b.19.1.0 (C:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml
igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss
insagttracmrnggnsfyaelkwlvsksagqnfpqttntyrntdtaehlimwgihhpss
tqekndlygtqslsisvgsstyrnnfvpvvgarpqvnglssridfhwtlvqpgdnitfsh
nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
yvnrrslmlatgmrnvpel

SCOPe Domain Coordinates for d5th1c_:

Click to download the PDB-style file with coordinates for d5th1c_.
(The format of our PDB-style files is described here.)

Timeline for d5th1c_: