Lineage for d5tgvf_ (5tgv F:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041677Species Influenza A virus, different strains [TaxId:11320] [255822] (26 PDB entries)
  8. 3041762Domain d5tgvf_: 5tgv F: [332724]
    Other proteins in same PDB: d5tgva_, d5tgvc_, d5tgve_
    automated match to d3m5jb_
    complexed with nag, sia; mutant

Details for d5tgvf_

PDB Entry: 5tgv (more details), 2.97 Å

PDB Description: crystal structure of h10 hemagglutinin mutant (k158aa-d193t-q226l- g228s) from jiangxi-donghu (2013) h10n8 influenza virus in complex with 3'-sln
PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5tgvf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tgvf_ h.3.1.1 (F:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

SCOPe Domain Coordinates for d5tgvf_:

Click to download the PDB-style file with coordinates for d5tgvf_.
(The format of our PDB-style files is described here.)

Timeline for d5tgvf_: