Lineage for d2ncha_ (2nch A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2400006Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2400007Protein automated matches [190576] (50 species)
    not a true protein
  7. 2400323Species Wolbachia endosymbiont [TaxId:292805] [332720] (1 PDB entry)
  8. 2400324Domain d2ncha_: 2nch A: [332721]
    automated match to d2n3sa_

Details for d2ncha_

PDB Entry: 2nch (more details)

PDB Description: solution structure of translation initiation factor if1 from wolbachia endosymbiont strain trs of brugia malayi
PDB Compounds: (A:) Translation initiation factor IF-1

SCOPe Domain Sequences for d2ncha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ncha_ b.40.4.0 (A:) automated matches {Wolbachia endosymbiont [TaxId: 292805]}
mvkdeksktlfevegavtallpaaefrvkldneheiichvsgkvrrskiriiigdrvlve
msiydrnakkgriirrlkgtsdrtisk

SCOPe Domain Coordinates for d2ncha_:

Click to download the PDB-style file with coordinates for d2ncha_.
(The format of our PDB-style files is described here.)

Timeline for d2ncha_: