Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (50 species) not a true protein |
Species Wolbachia endosymbiont [TaxId:292805] [332720] (1 PDB entry) |
Domain d2ncha_: 2nch A: [332721] automated match to d2n3sa_ |
PDB Entry: 2nch (more details)
SCOPe Domain Sequences for d2ncha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ncha_ b.40.4.0 (A:) automated matches {Wolbachia endosymbiont [TaxId: 292805]} mvkdeksktlfevegavtallpaaefrvkldneheiichvsgkvrrskiriiigdrvlve msiydrnakkgriirrlkgtsdrtisk
Timeline for d2ncha_: