Lineage for d5ksub1 (5ksu B:3-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938879Domain d5ksub1: 5ksu B:3-92 [332709]
    Other proteins in same PDB: d5ksua2, d5ksub2, d5ksud2, d5ksue2
    automated match to d1klub2

Details for d5ksub1

PDB Entry: 5ksu (more details), 2.73 Å

PDB Description: crystal structure of hla-dq2.5-clip1 at 2.73 resolution
PDB Compounds: (B:) MHC class II HLA-DQ-beta-1

SCOPe Domain Sequences for d5ksub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ksub1 d.19.1.0 (B:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn
sqkdilerkraavdrvcrhnyqlelrttlq

SCOPe Domain Coordinates for d5ksub1:

Click to download the PDB-style file with coordinates for d5ksub1.
(The format of our PDB-style files is described here.)

Timeline for d5ksub1: