| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
| Protein automated matches [226842] (5 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
| Domain d5ksub1: 5ksu B:3-92 [332709] Other proteins in same PDB: d5ksua2, d5ksub2, d5ksud2, d5ksue2 automated match to d1klub2 |
PDB Entry: 5ksu (more details), 2.73 Å
SCOPe Domain Sequences for d5ksub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ksub1 d.19.1.0 (B:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn
sqkdilerkraavdrvcrhnyqlelrttlq
Timeline for d5ksub1: