Lineage for d5jvlc3 (5jvl C:516-874)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2446508Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2446911Family c.1.12.0: automated matches [191427] (1 protein)
    not a true family
  6. 2446912Protein automated matches [190614] (15 species)
    not a true protein
  7. 2446977Species Flaveria trinervia [TaxId:4227] [332556] (3 PDB entries)
  8. 2446982Domain d5jvlc3: 5jvl C:516-874 [332698]
    Other proteins in same PDB: d5jvla1, d5jvla2, d5jvlb2, d5jvlb3, d5jvlc1, d5jvlc2, d5jvld1, d5jvld2
    automated match to d1vbga1
    complexed with 6nq, mg, pep

Details for d5jvlc3

PDB Entry: 5jvl (more details), 2.9 Å

PDB Description: c4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue
PDB Compounds: (C:) Pyruvate, phosphate dikinase, chloroplastic

SCOPe Domain Sequences for d5jvlc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jvlc3 c.1.12.0 (C:516-874) automated matches {Flaveria trinervia [TaxId: 4227]}
pamsndleifmswadqarrlkvmanadtpndaltarnngaqgiglcrtehmffasderik
avrkmimavtpeqrkvaldlllpyqrsdfegiframdglpvtirlldpplheflpegdle
hivnelavdtgmsadeiyskienlsevnpmlgfrgcrlgisypeltemqvraifqaavsm
tnqgvtvipeimvplvgtpqelrhqisvirgvaanvfaemgvtleykvgtmieipraali
aeeigkeadffsfgtndltqmtfgysrddvgkflqiylaqgilqhdpfevidqkgvgqli
kmatekgraanpslkvgicgehggepssvaffdgvgldyvscspfrvpiarlaaaqviv

SCOPe Domain Coordinates for d5jvlc3:

Click to download the PDB-style file with coordinates for d5jvlc3.
(The format of our PDB-style files is described here.)

Timeline for d5jvlc3: