Lineage for d5ja9a1 (5ja9 A:2-117)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (149 PDB entries)
  8. 2347737Domain d5ja9a1: 5ja9 A:2-117 [332693]
    Other proteins in same PDB: d5ja9a2, d5ja9b2
    automated match to d5h8da_
    complexed with edo, so4

Details for d5ja9a1

PDB Entry: 5ja9 (more details), 1.85 Å

PDB Description: crystal structure of the higb2 toxin in complex with nb6
PDB Compounds: (A:) Nanobody 6

SCOPe Domain Sequences for d5ja9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ja9a1 b.1.1.1 (A:2-117) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqpggslrlscaasgftfsnyamrwyrqapgeerefvafissvggstny
adsvkgrftisrdngkntlylqmnslkpedtavyfcvarlslisdswgqgtqvtvs

SCOPe Domain Coordinates for d5ja9a1:

Click to download the PDB-style file with coordinates for d5ja9a1.
(The format of our PDB-style files is described here.)

Timeline for d5ja9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ja9a2