Lineage for d5mwja1 (5mwj A:443-770)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2418201Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2418399Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2418400Family b.69.4.1: WD40-repeat [50979] (17 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 2418511Protein Groucho/tle1, C-terminal domain [75009] (1 species)
  7. 2418512Species Human (Homo sapiens) [TaxId:9606] [75010] (4 PDB entries)
  8. 2418519Domain d5mwja1: 5mwj A:443-770 [332688]
    Other proteins in same PDB: d5mwja2, d5mwjb2
    automated match to d1gxra_
    complexed with dms, ebu

Details for d5mwja1

PDB Entry: 5mwj (more details), 2.04 Å

PDB Description: structure enabled discovery of a stapled peptide inhibitor to target the oncogenic transcriptional repressor tle1
PDB Compounds: (A:) transducin-like enhancer protein 1

SCOPe Domain Sequences for d5mwja1:

Sequence, based on SEQRES records: (download)

>d5mwja1 b.69.4.1 (A:443-770) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtisnptrhvytg
gkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeastlsiwdlaap
tprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfqghtdgasci
disndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewlavgmessnve
vlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasifqskesssv
lscdisvddkyivtgsgdkkatvyeviy

Sequence, based on observed residues (ATOM records): (download)

>d5mwja1 b.69.4.1 (A:443-770) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kpaysfhvtqmqpvpfppdaligpgiprharqintlnhgevvcavtisnptrhvytggkg
cvkvwdisspvsqldclnrdnyirsckllpdgctlivggeastlsiwdlprikaeltssa
pacyalaispdskvcfsccsdgniavwdlhnqtlvrqfqghtdgascidisndgtklwtg
gldntvrswdlregrqlqqhdftsqifslgycptgewlavgmessnvevlhvnkpdkyql
hlhescvlslkfaycgkwfvstgkdnllnawrtpygasifqskesssvlscdisvddkyi
vtgsgdkkatvyeviy

SCOPe Domain Coordinates for d5mwja1:

Click to download the PDB-style file with coordinates for d5mwja1.
(The format of our PDB-style files is described here.)

Timeline for d5mwja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5mwja2