Lineage for d5lhda3 (5lhd A:549-636)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766973Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2766995Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 2766996Protein automated matches [254707] (4 species)
    not a true protein
  7. 2766997Species Human (Homo sapiens) [TaxId:9606] [255965] (22 PDB entries)
  8. 2767010Domain d5lhda3: 5lhd A:549-636 [332686]
    Other proteins in same PDB: d5lhda1, d5lhda2, d5lhda4, d5lhdb1, d5lhdb2, d5lhdb4, d5lhdc1, d5lhdc2, d5lhdc4, d5lhdd1, d5lhdd2, d5lhdd4
    automated match to d4fyta3
    complexed with edo, nag, zn

Details for d5lhda3

PDB Entry: 5lhd (more details), 2.6 Å

PDB Description: structure of glycosylated human aminopeptidase n
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d5lhda3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lhda3 b.1.30.0 (A:549-636) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fpvitvdtstgtlsqehflldpdsnvtrpsefnyvwivpitsirdgrqqqdywlidvraq
ndlfstsgnewvllnlnvtgyyrvnyde

SCOPe Domain Coordinates for d5lhda3:

Click to download the PDB-style file with coordinates for d5lhda3.
(The format of our PDB-style files is described here.)

Timeline for d5lhda3: