Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (20 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188286] (69 PDB entries) |
Domain d5lhda2: 5lhd A:288-548 [332685] Other proteins in same PDB: d5lhda1, d5lhda3, d5lhda4, d5lhdb1, d5lhdb3, d5lhdb4, d5lhdc1, d5lhdc3, d5lhdc4, d5lhdd1, d5lhdd3, d5lhdd4 automated match to d4fyta2 complexed with edo, nag, zn |
PDB Entry: 5lhd (more details), 2.6 Å
SCOPe Domain Sequences for d5lhda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lhda2 d.92.1.0 (A:288-548) automated matches {Human (Homo sapiens) [TaxId: 9606]} dyvekqasngvliriwarpsaiaaghgdyalnvtgpilnffaghydtpyplpksdqiglp dfnagamenwglvtyrensllfdplsssssnkervvtviahelahqwfgnlvtiewwndl wlnegfasyveylgadyaeptwnlkdlmvlndvyrvmavdalasshplstpaseintpaq iselfdaisyskgasvlrmlssflsedvfkqglasylhtfayqntiylnlwdhlqeavnn rsiqlpttvrdimnrwtlqmg
Timeline for d5lhda2: