Lineage for d1b96a_ (1b96 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 585880Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 585881Superfamily c.52.1: Restriction endonuclease-like [52980] (30 families) (S)
  5. 585894Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
  6. 585895Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 585896Species Escherichia coli [TaxId:562] [52986] (27 PDB entries)
  8. 585933Domain d1b96a_: 1b96 A: [33268]

Details for d1b96a_

PDB Entry: 1b96 (more details), 2.3 Å

PDB Description: analysis of a mutational hot-spot in the ecorv restriction endonuclease: a catalytic role for a main chain carbonyl group

SCOP Domain Sequences for d1b96a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b96a_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqenhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

SCOP Domain Coordinates for d1b96a_:

Click to download the PDB-style file with coordinates for d1b96a_.
(The format of our PDB-style files is described here.)

Timeline for d1b96a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b96b_