Lineage for d5mqvb_ (5mqv B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2586740Protein Casein kinase-1, CK1 [56139] (4 species)
    OPK group; CKI subfamily; serine/threonine kinase
  7. 2586746Species Human (Homo sapiens) [TaxId:9606] [224941] (25 PDB entries)
  8. 2586794Domain d5mqvb_: 5mqv B: [332678]
    automated match to d1ckia_
    complexed with d5q, po4

Details for d5mqvb_

PDB Entry: 5mqv (more details), 2.15 Å

PDB Description: crystal structure of human casein kinase i delta in complex with 4-(2, 5-dimethoxyphenyl)-n-(4-(5-(4-fluorphenyl)-2-(methylthio)-1h- imidazol-4-yl)-pyridin-2-yl)-1-methyl-1h-pyrrole-2-carboxamide
PDB Compounds: (B:) Casein kinase I isoform delta

SCOPe Domain Sequences for d5mqvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mqvb_ d.144.1.7 (B:) Casein kinase-1, CK1 {Human (Homo sapiens) [TaxId: 9606]}
ryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqggvgipt
irwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfihr
dvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthlg
ieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypse
fatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk

SCOPe Domain Coordinates for d5mqvb_:

Click to download the PDB-style file with coordinates for d5mqvb_.
(The format of our PDB-style files is described here.)

Timeline for d5mqvb_: