SCOPe 2.08: Domain d5ksvb1: 5ksv B:3-92

Lineage for d5ksvb1 (5ksv B:3-92)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)

8. Domain d5ksvb1: 5ksv B:3-92 [332676]
   Other proteins in same PDB: d5ksva2, d5ksvb2
   automated match to d1klub2

Details for d5ksvb1

PDB Entry: 5ksv, 2.2 Å

PDB Description: crystal structure of hla-dq2.5-clip2

PDB Compounds: (B:) MHC class II HLA-DQ-beta-1

SCOPe Domain Sequences for d5ksvb1:

Sequence; same for both SEQRES and ATOM records:

>d5ksvb1 d.19.1.0 (B:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn
sqkdilerkraavdrvcrhnyqlelrttlq

Timeline for d5ksvb1:

• d5ksvb1 first appeared in SCOPe 2.06
  
• d5ksvb1 appears in SCOPe 2.07