Lineage for d5lhdb4 (5lhd B:637-967)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2726072Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2726073Protein automated matches [190220] (14 species)
    not a true protein
  7. 2726099Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries)
  8. 2726133Domain d5lhdb4: 5lhd B:637-967 [332674]
    Other proteins in same PDB: d5lhda1, d5lhda2, d5lhda3, d5lhdb1, d5lhdb2, d5lhdb3, d5lhdc1, d5lhdc2, d5lhdc3, d5lhdd1, d5lhdd2, d5lhdd3
    automated match to d4fyta4
    complexed with edo, nag, zn

Details for d5lhdb4

PDB Entry: 5lhd (more details), 2.6 Å

PDB Description: structure of glycosylated human aminopeptidase n
PDB Compounds: (B:) Aminopeptidase N

SCOPe Domain Sequences for d5lhdb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lhdb4 a.118.1.0 (B:637-967) automated matches {Human (Homo sapiens) [TaxId: 9606]}
enwrkiqtqlqrdhsaipvinraqiindafnlasahkvpvtlalnntlflieerqympwe
aalsslsyfklmfdrsevygpmknylkkqvtplfihfrnntnnwreipenlmdqysevna
istacsngvpeceemvsglfkqwmenpnnnpihpnlrstvycnaiaqggeeewdfaweqf
rnatlvneadklraalacskelwilnrylsytlnpdlirkqdatstiisitnnvigqglv
wdfvqsnwkklfndygggsfsfsnliqavtrrfsteyelqqleqfkkdneetgfgsgtra
leqalektkanikwvkenkevvlqwftensk

SCOPe Domain Coordinates for d5lhdb4:

Click to download the PDB-style file with coordinates for d5lhdb4.
(The format of our PDB-style files is described here.)

Timeline for d5lhdb4: