Lineage for d5n0ia1 (5n0i A:41-270)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231713Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2231714Protein automated matches [190418] (18 species)
    not a true protein
  7. 2231748Species Klebsiella pneumoniae [TaxId:573] [189718] (37 PDB entries)
  8. 2231778Domain d5n0ia1: 5n0i A:41-270 [332673]
    Other proteins in same PDB: d5n0ia2, d5n0ib2
    automated match to d4eyba_
    complexed with bme, cl, gol, pg4, zn

Details for d5n0ia1

PDB Entry: 5n0i (more details), 1.47 Å

PDB Description: crystal structure of ndm-1 in complex with beta-mercaptoethanol - new refinement
PDB Compounds: (A:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d5n0ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n0ia1 d.157.1.0 (A:41-270) automated matches {Klebsiella pneumoniae [TaxId: 573]}
tgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaq
ilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhs
ltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgn
lgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d5n0ia1:

Click to download the PDB-style file with coordinates for d5n0ia1.
(The format of our PDB-style files is described here.)

Timeline for d5n0ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5n0ia2