Lineage for d5lhdb2 (5lhd B:288-548)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964873Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2964874Protein automated matches [190805] (20 species)
    not a true protein
  7. 2964907Species Human (Homo sapiens) [TaxId:9606] [188286] (69 PDB entries)
  8. 2965002Domain d5lhdb2: 5lhd B:288-548 [332671]
    Other proteins in same PDB: d5lhda1, d5lhda3, d5lhda4, d5lhdb1, d5lhdb3, d5lhdb4, d5lhdc1, d5lhdc3, d5lhdc4, d5lhdd1, d5lhdd3, d5lhdd4
    automated match to d4fyta2
    complexed with edo, nag, zn

Details for d5lhdb2

PDB Entry: 5lhd (more details), 2.6 Å

PDB Description: structure of glycosylated human aminopeptidase n
PDB Compounds: (B:) Aminopeptidase N

SCOPe Domain Sequences for d5lhdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lhdb2 d.92.1.0 (B:288-548) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dyvekqasngvliriwarpsaiaaghgdyalnvtgpilnffaghydtpyplpksdqiglp
dfnagamenwglvtyrensllfdplsssssnkervvtviahelahqwfgnlvtiewwndl
wlnegfasyveylgadyaeptwnlkdlmvlndvyrvmavdalasshplstpaseintpaq
iselfdaisyskgasvlrmlssflsedvfkqglasylhtfayqntiylnlwdhlqeavnn
rsiqlpttvrdimnrwtlqmg

SCOPe Domain Coordinates for d5lhdb2:

Click to download the PDB-style file with coordinates for d5lhdb2.
(The format of our PDB-style files is described here.)

Timeline for d5lhdb2: