Lineage for d5lhdb1 (5lhd B:64-287)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820567Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2820568Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2820655Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2820656Protein automated matches [254706] (5 species)
    not a true protein
  7. 2820660Species Human (Homo sapiens) [TaxId:9606] [255964] (28 PDB entries)
  8. 2820680Domain d5lhdb1: 5lhd B:64-287 [332670]
    Other proteins in same PDB: d5lhda2, d5lhda3, d5lhda4, d5lhdb2, d5lhdb3, d5lhdb4, d5lhdc2, d5lhdc3, d5lhdc4, d5lhdd2, d5lhdd3, d5lhdd4
    automated match to d4fyqa1
    complexed with edo, nag, zn

Details for d5lhdb1

PDB Entry: 5lhd (more details), 2.6 Å

PDB Description: structure of glycosylated human aminopeptidase n
PDB Compounds: (B:) Aminopeptidase N

SCOPe Domain Sequences for d5lhdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lhdb1 b.98.1.0 (B:64-287) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tldqskawnryrlpntlkpdsyrvtlrpyltpndrglyvfkgsstvrftckeatdviiih
skklnytlsqghrvvlrgvggsqppdidktelvepteylvvhlkgslvkdsqyemdsefe
geladdlagfyrseymegnvrkvvattqmqaadarksfpcfdepamkaefnitlihpkdl
talsnmlpkgpstplpedpnwnvtefhttpkmstyllafivsef

SCOPe Domain Coordinates for d5lhdb1:

Click to download the PDB-style file with coordinates for d5lhdb1.
(The format of our PDB-style files is described here.)

Timeline for d5lhdb1: