Lineage for d5ja8h1 (5ja8 H:7-121)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2744039Domain d5ja8h1: 5ja8 H:7-121 [332667]
    Other proteins in same PDB: d5ja8b2, d5ja8b3, d5ja8d2, d5ja8d3, d5ja8f2, d5ja8f3, d5ja8h2, d5ja8h3
    automated match to d4dkaa_
    complexed with act, edo, epe, pdo, po4

Details for d5ja8h1

PDB Entry: 5ja8 (more details), 2.49 Å

PDB Description: crystal structure of the higb2 toxin in complex with nb2
PDB Compounds: (H:) Nanobody 2

SCOPe Domain Sequences for d5ja8h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ja8h1 b.1.1.1 (H:7-121) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgftldyyaigwfrqapgkeregvscisssggttnyadsvk
grftvsrdnakntvylqmnslkpedtavyycvadfacplireydywgqgtqvtvs

SCOPe Domain Coordinates for d5ja8h1:

Click to download the PDB-style file with coordinates for d5ja8h1.
(The format of our PDB-style files is described here.)

Timeline for d5ja8h1: