Lineage for d5mtja_ (5mtj A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2571840Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2571841Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2572318Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2572319Protein automated matches [190561] (4 species)
    not a true protein
  7. 2572518Species Mouse (Mus musculus) [TaxId:10090] [226265] (5 PDB entries)
  8. 2572519Domain d5mtja_: 5mtj A: [332651]
    Other proteins in same PDB: d5mtjb_
    automated match to d3uyoa_
    complexed with cxs, so4

Details for d5mtja_

PDB Entry: 5mtj (more details), 1.95 Å

PDB Description: yes1-sh2 in complex with monobody mb(yes_1)
PDB Compounds: (A:) Tyrosine-protein kinase Yes

SCOPe Domain Sequences for d5mtja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mtja_ d.93.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qaeewyfgkmgrkdaerlllnpgnqrgiflvresettkgayslsirdwdevrgdnvkhyk
irkldnggyyittraqfdtlqklvkhytehadglchklttvcptvkpqt

SCOPe Domain Coordinates for d5mtja_:

Click to download the PDB-style file with coordinates for d5mtja_.
(The format of our PDB-style files is described here.)

Timeline for d5mtja_: