SCOPe 2.08: Domain d5mtja_: 5mtj A:

Lineage for d5mtja_ (5mtj A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [226265] (5 PDB entries)

8. Domain d5mtja_: 5mtj A: [332651]
   Other proteins in same PDB: d5mtjb_
   automated match to d3uyoa_
   complexed with cxs, so4

Details for d5mtja_

PDB Entry: 5mtj, 1.95 Å

PDB Description: yes1-sh2 in complex with monobody mb(yes_1)

PDB Compounds: (A:) Tyrosine-protein kinase Yes

SCOPe Domain Sequences for d5mtja_:

Sequence; same for both SEQRES and ATOM records:

>d5mtja_ d.93.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qaeewyfgkmgrkdaerlllnpgnqrgiflvresettkgayslsirdwdevrgdnvkhyk
irkldnggyyittraqfdtlqklvkhytehadglchklttvcptvkpqt

Timeline for d5mtja_:

• d5mtja_ first appeared in SCOPe 2.06
  
• d5mtja_ appears in SCOPe 2.07