| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
| Family d.93.1.0: automated matches [191409] (1 protein) not a true family |
| Protein automated matches [190561] (4 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [226265] (5 PDB entries) |
| Domain d5mtja_: 5mtj A: [332651] Other proteins in same PDB: d5mtjb_ automated match to d3uyoa_ complexed with cxs, so4 |
PDB Entry: 5mtj (more details), 1.95 Å
SCOPe Domain Sequences for d5mtja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mtja_ d.93.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qaeewyfgkmgrkdaerlllnpgnqrgiflvresettkgayslsirdwdevrgdnvkhyk
irkldnggyyittraqfdtlqklvkhytehadglchklttvcptvkpqt
Timeline for d5mtja_: