Lineage for d5ksue2 (5ksu E:93-189)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2368806Domain d5ksue2: 5ksu E:93-189 [332650]
    Other proteins in same PDB: d5ksua1, d5ksua2, d5ksub1, d5ksud1, d5ksud2, d5ksue1
    automated match to d1sebb1

Details for d5ksue2

PDB Entry: 5ksu (more details), 2.73 Å

PDB Description: crystal structure of hla-dq2.5-clip1 at 2.73 resolution
PDB Compounds: (E:) MHC class II HLA-DQ-beta-1

SCOPe Domain Sequences for d5ksue2:

Sequence, based on SEQRES records: (download)

>d5ksue2 b.1.1.0 (E:93-189) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeetagvvstplirngd
wtfqilvmlemtpqrgdvytchvehpslqspitvewr

Sequence, based on observed residues (ATOM records): (download)

>d5ksue2 b.1.1.0 (E:93-189) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispsnllvcsvtdfypaqikvrwfrndqeetagvvstplirngdwtfqilvm
lemtpqrgdvytchvehpslqspitvewr

SCOPe Domain Coordinates for d5ksue2:

Click to download the PDB-style file with coordinates for d5ksue2.
(The format of our PDB-style files is described here.)

Timeline for d5ksue2: