SCOPe 2.06: Domain d5ksue2: 5ksu E:93-189

Lineage for d5ksue2 (5ksu E:93-189)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d5ksue2: 5ksu E:93-189 [332650]
   Other proteins in same PDB: d5ksua1, d5ksua2, d5ksub1, d5ksud1, d5ksud2, d5ksue1
   automated match to d1sebb1

Details for d5ksue2

PDB Entry: 5ksu, 2.73 Å

PDB Description: crystal structure of hla-dq2.5-clip1 at 2.73 resolution

PDB Compounds: (E:) MHC class II HLA-DQ-beta-1

SCOPe Domain Sequences for d5ksue2:

Sequence, based on SEQRES records:

>d5ksue2 b.1.1.0 (E:93-189) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeetagvvstplirngd
wtfqilvmlemtpqrgdvytchvehpslqspitvewr

Sequence, based on observed residues (ATOM records):

>d5ksue2 b.1.1.0 (E:93-189) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispsnllvcsvtdfypaqikvrwfrndqeetagvvstplirngdwtfqilvm
lemtpqrgdvytchvehpslqspitvewr

Timeline for d5ksue2:

• d5ksue2 is new in SCOPe 2.06-stable
  
• d5ksue2 appears in SCOPe 2.07
  
• d5ksue2 appears in the current release, SCOPe 2.08