SCOPe 2.06: Domain d5ja8b1: 5ja8 B:2-121

Lineage for d5ja8b1 (5ja8 B:2-121)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (22 species)
not a true protein
Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)
Domain d5ja8b1: 5ja8 B:2-121 [332647]
Other proteins in same PDB: d5ja8b2, d5ja8d2, d5ja8f2, d5ja8h2
automated match to d4dkaa_
complexed with act, edo, epe, pdo, po4

Details for d5ja8b1

PDB Entry: 5ja8 (more details), 2.49 Å

PDB Description: crystal structure of the higb2 toxin in complex with nb2

PDB Compounds: (B:) Nanobody 2

SCOPe Domain Sequences for d5ja8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ja8b1 b.1.1.1 (B:2-121) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqpggslrlscaasgftldyyaigwfrqapgkeregvscisssggttny
adsvkgrftvsrdnakntvylqmnslkpedtavyycvadfacplireydywgqgtqvtvs

SCOPe Domain Coordinates for d5ja8b1:

Click to download the PDB-style file with coordinates for d5ja8b1.
(The format of our PDB-style files is described here.)

Timeline for d5ja8b1: