| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
| Protein Casein kinase-1, CK1 [56139] (4 species) OPK group; CKI subfamily; serine/threonine kinase |
| Species Human (Homo sapiens) [TaxId:9606] [224941] (25 PDB entries) |
| Domain d5mqvc_: 5mqv C: [332646] automated match to d1ckia_ complexed with d5q, po4 |
PDB Entry: 5mqv (more details), 2.15 Å
SCOPe Domain Sequences for d5mqvc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mqvc_ d.144.1.7 (C:) Casein kinase-1, CK1 {Human (Homo sapiens) [TaxId: 9606]}
gnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqggvgi
ptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfi
hrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinth
lgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgyp
sefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnml
Timeline for d5mqvc_: