Lineage for d1b95a_ (1b95 A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71527Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
  4. 71528Superfamily c.52.1: Restriction endonuclease-like [52980] (18 families) (S)
  5. 71541Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
  6. 71542Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 71543Species Escherichia coli [TaxId:562] [52986] (23 PDB entries)
  8. 71568Domain d1b95a_: 1b95 A: [33264]

Details for d1b95a_

PDB Entry: 1b95 (more details), 2.05 Å

PDB Description: analysis of a mutational hot-spot in the ecorv restriction endonuclease: a catalytic role for a main chain carbonyl group

SCOP Domain Sequences for d1b95a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b95a_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

SCOP Domain Coordinates for d1b95a_:

Click to download the PDB-style file with coordinates for d1b95a_.
(The format of our PDB-style files is described here.)

Timeline for d1b95a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b95b_