Lineage for d5mo4a1 (5mo4 A:83-139)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783254Protein automated matches [190043] (8 species)
    not a true protein
  7. 2783282Species Human (Homo sapiens) [TaxId:9606] [187799] (37 PDB entries)
  8. 2783320Domain d5mo4a1: 5mo4 A:83-139 [332639]
    Other proteins in same PDB: d5mo4a2, d5mo4a3
    automated match to d1opka1
    complexed with ay7, nil

Details for d5mo4a1

PDB Entry: 5mo4 (more details), 2.17 Å

PDB Description: abl1 kinase (t334i_d382n) in complex with asciminib and nilotinib
PDB Compounds: (A:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d5mo4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mo4a1 b.34.2.1 (A:83-139) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvn

SCOPe Domain Coordinates for d5mo4a1:

Click to download the PDB-style file with coordinates for d5mo4a1.
(The format of our PDB-style files is described here.)

Timeline for d5mo4a1: