Lineage for d5j1ua2 (5j1u A:95-214)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2727852Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2727859Protein Ethr repressor [109978] (2 species)
  7. 2727860Species Mycobacterium tuberculosis [TaxId:1773] [109979] (65 PDB entries)
    Uniprot P96222 22-215
  8. 2727889Domain d5j1ua2: 5j1u A:95-214 [332638]
    Other proteins in same PDB: d5j1ua1
    automated match to d1t56a2
    complexed with p93

Details for d5j1ua2

PDB Entry: 5j1u (more details), 1.8 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with n-(furan-3-ylmethyl) pyrrolidine-1-carboxamide at 1.80a resolution
PDB Compounds: (A:) EthR

SCOPe Domain Sequences for d5j1ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j1ua2 a.121.1.1 (A:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

SCOPe Domain Coordinates for d5j1ua2:

Click to download the PDB-style file with coordinates for d5j1ua2.
(The format of our PDB-style files is described here.)

Timeline for d5j1ua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5j1ua1