Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) |
Family c.1.12.0: automated matches [191427] (1 protein) not a true family |
Protein automated matches [190614] (15 species) not a true protein |
Species Flaveria pringlei [TaxId:4226] [332632] (1 PDB entry) |
Domain d5jvna3: 5jvn A:514-874 [332633] Other proteins in same PDB: d5jvna1, d5jvna2, d5jvna4 automated match to d2x0sa1 complexed with 6nq, mg, pep |
PDB Entry: 5jvn (more details), 2.9 Å
SCOPe Domain Sequences for d5jvna3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jvna3 c.1.12.0 (A:514-874) automated matches {Flaveria pringlei [TaxId: 4226]} appamsndletfmswadqvrrlkvmanadtpndaltarnngaqgiglcrtehmffasder ikavrkmimavtpeqrkaaldlllpyqrsdfegiframdglpvtirlldpplheflpegd lehivnelavdtgmsedeiyskieklsevnpmlgfrgcrlgisypeltemqvraifqaav smnnqgvtvipeimvplvgtpqelrhqigvirgvaanvfaemgltmdykvgtmieipraa liaeeiakeaeffsfgtndltqmtfgysrddvgkflqiylsqgilqhdpfevldqkgvgq likmatekgraanpnlkvgicgehggepssvaffdgvgldyvscspfrvpiarlaaaqvv v
Timeline for d5jvna3: