Lineage for d5jvna3 (5jvn A:514-874)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2100061Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2100415Family c.1.12.0: automated matches [191427] (1 protein)
    not a true family
  6. 2100416Protein automated matches [190614] (15 species)
    not a true protein
  7. 2100479Species Flaveria pringlei [TaxId:4226] [332632] (1 PDB entry)
  8. 2100480Domain d5jvna3: 5jvn A:514-874 [332633]
    Other proteins in same PDB: d5jvna1, d5jvna2, d5jvna4
    automated match to d2x0sa1
    complexed with 6nq, mg, pep

Details for d5jvna3

PDB Entry: 5jvn (more details), 2.9 Å

PDB Description: c3-type pyruvate phosphate dikinase: intermediate state of the central domain in the swiveling mechanism
PDB Compounds: (A:) Pyruvate, phosphate dikinase, chloroplastic

SCOPe Domain Sequences for d5jvna3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jvna3 c.1.12.0 (A:514-874) automated matches {Flaveria pringlei [TaxId: 4226]}
appamsndletfmswadqvrrlkvmanadtpndaltarnngaqgiglcrtehmffasder
ikavrkmimavtpeqrkaaldlllpyqrsdfegiframdglpvtirlldpplheflpegd
lehivnelavdtgmsedeiyskieklsevnpmlgfrgcrlgisypeltemqvraifqaav
smnnqgvtvipeimvplvgtpqelrhqigvirgvaanvfaemgltmdykvgtmieipraa
liaeeiakeaeffsfgtndltqmtfgysrddvgkflqiylsqgilqhdpfevldqkgvgq
likmatekgraanpnlkvgicgehggepssvaffdgvgldyvscspfrvpiarlaaaqvv
v

SCOPe Domain Coordinates for d5jvna3:

Click to download the PDB-style file with coordinates for d5jvna3.
(The format of our PDB-style files is described here.)

Timeline for d5jvna3: