SCOPe 2.07: Domain d5jvna2: 5jvn A:380-513

Lineage for d5jvna2 (5jvn A:380-513)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.1: Phosphohistidine domain [52009] (3 families)
   contains barrel, closed, n=7, S=10

5. Family c.8.1.0: automated matches [310665] (1 protein)
   not a true family

6. Protein automated matches [310840] (3 species)
   not a true protein

7. Species Flaveria pringlei [TaxId:4226] [332630] (1 PDB entry)

8. Domain d5jvna2: 5jvn A:380-513 [332631]
   Other proteins in same PDB: d5jvna1, d5jvna3, d5jvna4
   automated match to d2x0sa2
   complexed with 6nq, mg, pep

Details for d5jvna2

PDB Entry: 5jvn, 2.9 Å

PDB Description: c3-type pyruvate phosphate dikinase: intermediate state of the central domain in the swiveling mechanism

PDB Compounds: (A:) Pyruvate, phosphate dikinase, chloroplastic

SCOPe Domain Sequences for d5jvna2:

Sequence, based on SEQRES records:

>d5jvna2 c.8.1.0 (A:380-513) automated matches {Flaveria pringlei [TaxId: 4226]}
pqfenpsaykshvvatglpaspgaavgqvvfsaedaetwhaqgksailvrtetspedvgg
mhaaagiltarggmtshaavvargwgkccvsgcadirvnddmkvltigdrvikegdwlsl
ngstgevilgkqll

Sequence, based on observed residues (ATOM records):

>d5jvna2 c.8.1.0 (A:380-513) automated matches {Flaveria pringlei [TaxId: 4226]}
pqfenpsaykshvvatglpaspgaavgqvvfsaedaetwhaqgksailvrtetspedvgg
mhaaagiltarggmtshaavvargwgkccvsgcadirvnddmkvltirvikegdwlslng
stgevilgkqll

Timeline for d5jvna2:

• d5jvna2 first appeared in SCOPe 2.06
  
• d5jvna2 appears in the current release, SCOPe 2.08