SCOPe 2.06: Domain d5jvna1: 5jvn A:1-379

Lineage for d5jvna1 (5jvn A:1-379)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (32 species)
   not a true protein

7. Species Flaveria pringlei [TaxId:4226] [332628] (1 PDB entry)

8. Domain d5jvna1: 5jvn A:1-379 [332629]
   Other proteins in same PDB: d5jvna2, d5jvna3, d5jvna4
   automated match to d2x0sa3
   complexed with 6nq, mg, pep

Details for d5jvna1

PDB Entry: 5jvn, 2.9 Å

PDB Description: c3-type pyruvate phosphate dikinase: intermediate state of the central domain in the swiveling mechanism

PDB Compounds: (A:) Pyruvate, phosphate dikinase, chloroplastic

SCOPe Domain Sequences for d5jvna1:

Sequence; same for both SEQRES and ATOM records:

>d5jvna1 d.142.1.0 (A:1-379) automated matches {Flaveria pringlei [TaxId: 4226]}
kkrvftfgkgrsegnkdmksllggkganlaemasiglsvppgltisteaceeyqqngkkl
ppglwdeileglryvqkemsaslgdpskplllsvrsgaaismpgmmdtvlnlglndevva
glagksgarfaydsyrrfldmfgnvvmgiphslfdekleemkaekgvhldtdltaadlkd
lveqyknvyveakgekfptdpkkqlelavnavfdswdsprankyrsinqitglkgtavni
qcmvfgnmgntsgtgvlftrnpstgekklygeflvnaqgedvvagirtpedlatmetcmp
eayrelvenckilerhykdmmdieftvqenrlwmlqcrtgkrtgkgavriavdmvnegli
dtrtaikrvetqhldqllh

Timeline for d5jvna1:

• d5jvna1 is new in SCOPe 2.06-stable
  
• d5jvna1 appears in SCOPe 2.07
  
• d5jvna1 appears in the current release, SCOPe 2.08