| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein automated matches [190359] (43 species) not a true protein |
| Species Peromyscus maniculatus [TaxId:10042] [196779] (2 PDB entries) |
| Domain d5kerb_: 5ker B: [332627] automated match to d4h2lb_ complexed with hem |
PDB Entry: 5ker (more details), 2.2 Å
SCOPe Domain Sequences for d5kerb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kerb_ a.1.1.2 (B:) automated matches {Peromyscus maniculatus [TaxId: 10042]}
vhltdaekalvtglwgkvkpeeiggealgrllavypwtqrffdsfgdlssasaimgnakv
kghgkkvidsfgeglkhldnlkgtfaslselhcdklhvdpenfkllgnmivivmahhlgk
dftpaaqaayqkvvagvatalahkyh
Timeline for d5kerb_: