![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156 |
![]() | Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) ![]() the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase |
![]() | Family c.101.1.0: automated matches [191361] (1 protein) not a true family |
![]() | Protein automated matches [190431] (13 species) not a true protein |
![]() | Species Solanum habrochaites [TaxId:62890] [332525] (5 PDB entries) |
![]() | Domain d5hxna_: 5hxn A: [332625] automated match to d4h8ea_ mutant |
PDB Entry: 5hxn (more details), 2.05 Å
SCOPe Domain Sequences for d5hxna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hxna_ c.101.1.0 (A:) automated matches {Solanum habrochaites [TaxId: 62890]} lmpkhialimdgnrrwakdkgldvseghkhlfpklkeicdissklgiqvitafafstenw krakgevdflmqmfeelydefsrsgvrvsiigcktdlpmtlqkcialteettkgnkglhl vialnyggyydilqatksivnkamnglldvedinknlfdqeleskcpnpdllirtggdqr vsnfllwqlaytefyftktlfpdfgeedlkeaiinfqqrh
Timeline for d5hxna_: