SCOPe 2.06: Domain d5ksud1: 5ksu D:0-81

Lineage for d5ksud1 (5ksu D:0-81)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries)

8. Domain d5ksud1: 5ksu D:0-81 [332622]
   Other proteins in same PDB: d5ksua2, d5ksub2, d5ksud2, d5ksue2
   automated match to d4ozfa1

Details for d5ksud1

PDB Entry: 5ksu, 2.73 Å

PDB Description: crystal structure of hla-dq2.5-clip1 at 2.73 resolution

PDB Compounds: (D:) HLA class II histocompatibility antigen, DQ alpha 1 chain

SCOPe Domain Sequences for d5ksud1:

Sequence; same for both SEQRES and ATOM records:

>d5ksud1 d.19.1.0 (D:0-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqfa
ltniavlkhnlnslikrsnsta

Timeline for d5ksud1:

• d5ksud1 is new in SCOPe 2.06-stable
  
• d5ksud1 appears in SCOPe 2.07
  
• d5ksud1 appears in the current release, SCOPe 2.08