Lineage for d5ksud1 (5ksu D:0-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938880Domain d5ksud1: 5ksu D:0-81 [332622]
    Other proteins in same PDB: d5ksua2, d5ksub2, d5ksud2, d5ksue2
    automated match to d4ozfa1

Details for d5ksud1

PDB Entry: 5ksu (more details), 2.73 Å

PDB Description: crystal structure of hla-dq2.5-clip1 at 2.73 resolution
PDB Compounds: (D:) HLA class II histocompatibility antigen, DQ alpha 1 chain

SCOPe Domain Sequences for d5ksud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ksud1 d.19.1.0 (D:0-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqfa
ltniavlkhnlnslikrsnsta

SCOPe Domain Coordinates for d5ksud1:

Click to download the PDB-style file with coordinates for d5ksud1.
(The format of our PDB-style files is described here.)

Timeline for d5ksud1: