Lineage for d5ksua2 (5ksu A:82-181)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361253Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 2363098Domain d5ksua2: 5ksu A:82-181 [332616]
    Other proteins in same PDB: d5ksua1, d5ksub1, d5ksub2, d5ksud1, d5ksue1, d5ksue2
    automated match to d4ozfa2

Details for d5ksua2

PDB Entry: 5ksu (more details), 2.73 Å

PDB Description: crystal structure of hla-dq2.5-clip1 at 2.73 resolution
PDB Compounds: (A:) HLA class II histocompatibility antigen, DQ alpha 1 chain

SCOPe Domain Sequences for d5ksua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ksua2 b.1.1.2 (A:82-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atnevpevtvfskspvtlgqpniliclvdnifppvvnitwlsnghsvtegvsetsflsks
dhsffkisyltllpsaeesydckvehwgldkpllkhwepe

SCOPe Domain Coordinates for d5ksua2:

Click to download the PDB-style file with coordinates for d5ksua2.
(The format of our PDB-style files is described here.)

Timeline for d5ksua2: