Lineage for d5ksua1 (5ksu A:0-81)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2545715Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2545716Protein automated matches [226842] (5 species)
    not a true protein
  7. 2545737Species Human (Homo sapiens) [TaxId:9606] [226044] (102 PDB entries)
  8. 2545904Domain d5ksua1: 5ksu A:0-81 [332615]
    Other proteins in same PDB: d5ksua2, d5ksub2, d5ksud2, d5ksue2
    automated match to d4ozfa1

Details for d5ksua1

PDB Entry: 5ksu (more details), 2.73 Å

PDB Description: crystal structure of hla-dq2.5-clip1 at 2.73 resolution
PDB Compounds: (A:) HLA class II histocompatibility antigen, DQ alpha 1 chain

SCOPe Domain Sequences for d5ksua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ksua1 d.19.1.0 (A:0-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqfa
ltniavlkhnlnslikrsnsta

SCOPe Domain Coordinates for d5ksua1:

Click to download the PDB-style file with coordinates for d5ksua1.
(The format of our PDB-style files is described here.)

Timeline for d5ksua1: