Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (28 families) |
Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
Protein automated matches [190220] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries) |
Domain d5lhdd4: 5lhd D:637-967 [332614] Other proteins in same PDB: d5lhda1, d5lhda2, d5lhda3, d5lhdb1, d5lhdb2, d5lhdb3, d5lhdc1, d5lhdc2, d5lhdc3, d5lhdd1, d5lhdd2, d5lhdd3 automated match to d4fyta4 complexed with edo, nag, zn |
PDB Entry: 5lhd (more details), 2.6 Å
SCOPe Domain Sequences for d5lhdd4:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lhdd4 a.118.1.0 (D:637-967) automated matches {Human (Homo sapiens) [TaxId: 9606]} enwrkiqtqlqrdhsaipvinraqiindafnlasahkvpvtlalnntlflieerqympwe aalsslsyfklmfdrsevygpmknylkkqvtplfihfrnntnnwreipenlmdqysevna istacsngvpeceemvsglfkqwmenpnnnpihpnlrstvycnaiaqggeeewdfaweqf rnatlvneadklraalacskelwilnrylsytlnpdlirkqdatstiisitnnvigqglv wdfvqsnwkklfndygggsfsfsnliqavtrrfsteyelqqleqfkkdneetgfgsgtra leqalektkanikwvkenkevvlqwftensk
Timeline for d5lhdd4: