![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.139: Type I dockerin domain [63445] (1 superfamily) tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand |
![]() | Superfamily a.139.1: Type I dockerin domain [63446] (2 families) ![]() |
![]() | Family a.139.1.0: automated matches [191542] (1 protein) not a true family |
![]() | Protein automated matches [190928] (7 species) not a true protein |
![]() | Species Clostridium thermocellum [TaxId:203119] [194257] (4 PDB entries) |
![]() | Domain d5g5db2: 5g5d B:104-163 [332610] Other proteins in same PDB: d5g5da_, d5g5db1 automated match to d2b59b1 complexed with ca |
PDB Entry: 5g5d (more details), 3 Å
SCOPe Domain Sequences for d5g5db2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g5db2 a.139.1.0 (B:104-163) automated matches {Clostridium thermocellum [TaxId: 203119]} vkdnsinlldvaevircfnatkgsanyveeldinrngainmqdimivhkhfgatssdyda
Timeline for d5g5db2: