SCOPe 2.08: Domain d5g5db2: 5g5d B:104-163

Lineage for d5g5db2 (5g5d B:104-163)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.139: Type I dockerin domain [63445] (1 superfamily)
   tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand

4. Superfamily a.139.1: Type I dockerin domain [63446] (2 families)

5. Family a.139.1.0: automated matches [191542] (1 protein)
   not a true family

6. Protein automated matches [190928] (7 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:203119] [194257] (4 PDB entries)

8. Domain d5g5db2: 5g5d B:104-163 [332610]
   Other proteins in same PDB: d5g5da_, d5g5db1
   automated match to d2b59b1
   complexed with ca

Details for d5g5db2

PDB Entry: 5g5d, 3 Å

PDB Description: crystal structure of the cohscac2-xdoccipa type ii complex from clostridium thermocellum

PDB Compounds: (B:) Cellulosomal-scaffolding protein A

SCOPe Domain Sequences for d5g5db2:

Sequence; same for both SEQRES and ATOM records:

>d5g5db2 a.139.1.0 (B:104-163) automated matches {Clostridium thermocellum [TaxId: 203119]}
vkdnsinlldvaevircfnatkgsanyveeldinrngainmqdimivhkhfgatssdyda

Timeline for d5g5db2:

• d5g5db2 first appeared in SCOPe 2.06
  
• d5g5db2 appears in SCOPe 2.07