Lineage for d5g5db1 (5g5d B:8-103)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768765Superfamily b.3.2: Carboxypeptidase regulatory domain-like [49464] (3 families) (S)
  5. 2768774Family b.3.2.2: Pre-dockerin domain [141082] (2 proteins)
    PfamB PB085396
  6. 2768778Protein automated matches [332607] (1 species)
    not a true protein
  7. 2768779Species Clostridium thermocellum [TaxId:203119] [332608] (1 PDB entry)
  8. 2768780Domain d5g5db1: 5g5d B:8-103 [332609]
    Other proteins in same PDB: d5g5da_, d5g5db2
    automated match to d2b59b2
    complexed with ca

Details for d5g5db1

PDB Entry: 5g5d (more details), 3 Å

PDB Description: crystal structure of the cohscac2-xdoccipa type ii complex from clostridium thermocellum
PDB Compounds: (B:) Cellulosomal-scaffolding protein A

SCOPe Domain Sequences for d5g5db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g5db1 b.3.2.2 (B:8-103) automated matches {Clostridium thermocellum [TaxId: 203119]}
gykvsgyilpdfsfdatvaplvkagfkveivgtelyavtdangyfeitgvpanasgytlk
isratyldrvianvvvtgdtsvstsqapimmwvgki

SCOPe Domain Coordinates for d5g5db1:

Click to download the PDB-style file with coordinates for d5g5db1.
(The format of our PDB-style files is described here.)

Timeline for d5g5db1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5g5db2
View in 3D
Domains from other chains:
(mouse over for more information)
d5g5da_