Lineage for d5l9na_ (5l9n A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. Protein PII (product of glnB) [54915] (8 species)
    trimer with orthogonal packing of beta-sheets around the threefold axis
  7. Species Escherichia coli [TaxId:83333] [332601] (1 PDB entry)
  8. Domain d5l9na_: 5l9n A: [332602]
    automated match to d2piia_
    complexed with atp, mg

Details for d5l9na_

PDB Entry: 5l9n (more details), 1.9 Å

PDB Description: structure of uridylylated glnb from escherichia coli bound to atp
PDB Compounds: (A:) Nitrogen regulatory protein P-II 1

SCOPe Domain Sequences for d5l9na_:

Sequence, based on SEQRES records: (download)

>d5l9na_ d.58.5.1 (A:) PII (product of glnB) {Escherichia coli [TaxId: 83333]}
mkkidaiikpfklddvrealaevgitgmtvtevkgfgrqkghtelyrgaeymvdflpkvk
ieivvpddivdtcvdtiirtaqtgkigdgkifvfdvarvirirtgeedd

Sequence, based on observed residues (ATOM records): (download)

>d5l9na_ d.58.5.1 (A:) PII (product of glnB) {Escherichia coli [TaxId: 83333]}
mkkidaiikpfklddvrealaevgitgmtvtevkgfdflpkvkieivvpddivdtcvdti
irtaqtgkigdgkifvfdvarvirirtgeedd

SCOPe Domain Coordinates for d5l9na_ are not available.

Timeline for d5l9na_: