Lineage for d1eo3a_ (1eo3 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24772Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
  4. 24773Superfamily c.52.1: Restriction endonuclease-like [52980] (17 families) (S)
  5. 24786Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
  6. 24787Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 24788Species Escherichia coli [TaxId:562] [52986] (23 PDB entries)
  8. 24811Domain d1eo3a_: 1eo3 A: [33260]

Details for d1eo3a_

PDB Entry: 1eo3 (more details), 2 Å

PDB Description: inhibition of ecorv endonuclease by deoxyribo-3'-s-phosphorothiolates: a high resolution x-ray crystallographic study

SCOP Domain Sequences for d1eo3a_:

Sequence, based on SEQRES records: (download)

>d1eo3a_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

Sequence, based on observed residues (ATOM records): (download)

>d1eo3a_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatksslktynilneipkpykgvkvflqdkwviagdlagsg
nttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiyrgr
k

SCOP Domain Coordinates for d1eo3a_:

Click to download the PDB-style file with coordinates for d1eo3a_.
(The format of our PDB-style files is described here.)

Timeline for d1eo3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1eo3b_