SCOPe 2.06: Domain d5jzsa_: 5jzs A:

Lineage for d5jzsa_ (5jzs A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (91 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [189096] (7 PDB entries)

8. Domain d5jzsa_: 5jzs A: [332598]
   automated match to d2vf2a_
   complexed with fgz

Details for d5jzsa_

PDB Entry: 5jzs, 2.27 Å

PDB Description: hsad bound to 3,5-dichloro-4-hydroxybenzoic acid

PDB Compounds: (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase bphd

SCOPe Domain Sequences for d5jzsa_:

Sequence; same for both SEQRES and ATOM records:

>d5jzsa_ c.69.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ltfestsrfaevdvdgplklhyheagvgndqtvvllhgggpgaaswtnfsrniavlarhf
hvlavdqpgyghsdkraehgqfnryaamalkglfdqlglgrvplvgnslgggtavrfald
yparagrlvlmgpgglsinlfapdptegvkrlskfsvaptrenleaflrvmvydknlitp
elvdqrfalastpesltatramgksfagadfeagmmwrevyrlrqpvlliwgredrvnpl
dgalvalktipraqlhvfgqcghwvqvekfdefnkltieflggg

Timeline for d5jzsa_:

• d5jzsa_ is new in SCOPe 2.06-stable
  
• d5jzsa_ appears in SCOPe 2.07
  
• d5jzsa_ appears in the current release, SCOPe 2.08