Lineage for d5jvld1 (5jvl D:1-380)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2979068Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2979069Protein automated matches [226904] (39 species)
    not a true protein
  7. 2979133Species Flaveria trinervia [TaxId:4227] [332552] (3 PDB entries)
  8. 2979139Domain d5jvld1: 5jvl D:1-380 [332595]
    Other proteins in same PDB: d5jvla2, d5jvla3, d5jvlb1, d5jvlb3, d5jvlc2, d5jvlc3, d5jvld2, d5jvld3
    automated match to d1vbga3
    complexed with 6nq, mg, pep

Details for d5jvld1

PDB Entry: 5jvl (more details), 2.9 Å

PDB Description: c4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue
PDB Compounds: (D:) Pyruvate, phosphate dikinase, chloroplastic

SCOPe Domain Sequences for d5jvld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jvld1 d.142.1.0 (D:1-380) automated matches {Flaveria trinervia [TaxId: 4227]}
kkrvftfgkgrsegnrdmksllggkganlaemssiglsvppgltisteaceeyqqngksl
ppglwdeisegldyvqkemsaslgdpskplllsvrsgaaismpgmmdtvlnlglndevva
glagksgarfaydsyrrfldmfgnvvmgiphslfdekleqmkaekgihldtdltaadlkd
lvekyknvyveakgekfptdpkkqlelavnavfdswdsprankyrsinqitglkgtavni
qsmvfgnmgntsgtgvlftrnpstgekklygeflinaqgedvvagirtpedlgtmetcmp
eaykelvenceilerhykdmmdieftvqenrlwmlqcrtgkrtgkgavriavdmvnegli
dtrtaikrvetqhldqllhp

SCOPe Domain Coordinates for d5jvld1:

Click to download the PDB-style file with coordinates for d5jvld1.
(The format of our PDB-style files is described here.)

Timeline for d5jvld1: