Lineage for d5kerh_ (5ker H:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1978657Protein automated matches [190359] (42 species)
    not a true protein
  7. 1978928Species Peromyscus maniculatus [TaxId:10042] [196779] (2 PDB entries)
  8. 1978937Domain d5kerh_: 5ker H: [332590]
    automated match to d4h2lb_
    complexed with hem

Details for d5kerh_

PDB Entry: 5ker (more details), 2.2 Å

PDB Description: deer mouse recombinant hemoglobin from high altitude species
PDB Compounds: (H:) Beta globin

SCOPe Domain Sequences for d5kerh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kerh_ a.1.1.2 (H:) automated matches {Peromyscus maniculatus [TaxId: 10042]}
vhltdaekalvtglwgkvkpeeiggealgrllavypwtqrffdsfgdlssasaimgnakv
kghgkkvidsfgeglkhldnlkgtfaslselhcdklhvdpenfkllgnmivivmahhlgk
dftpaaqaayqkvvagvatalahkyh

SCOPe Domain Coordinates for d5kerh_:

Click to download the PDB-style file with coordinates for d5kerh_.
(The format of our PDB-style files is described here.)

Timeline for d5kerh_: