Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) same topology as (b.1.15.1) |
Family b.1.30.0: automated matches [254306] (1 protein) not a true family |
Protein automated matches [254707] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255965] (22 PDB entries) |
Domain d5lhdc3: 5lhd C:549-636 [332587] Other proteins in same PDB: d5lhda1, d5lhda2, d5lhda4, d5lhdb1, d5lhdb2, d5lhdb4, d5lhdc1, d5lhdc2, d5lhdc4, d5lhdd1, d5lhdd2, d5lhdd4 automated match to d4fyta3 complexed with edo, nag, zn |
PDB Entry: 5lhd (more details), 2.6 Å
SCOPe Domain Sequences for d5lhdc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lhdc3 b.1.30.0 (C:549-636) automated matches {Human (Homo sapiens) [TaxId: 9606]} fpvitvdtstgtlsqehflldpdsnvtrpsefnyvwivpitsirdgrqqqdywlidvraq ndlfstsgnewvllnlnvtgyyrvnyde
Timeline for d5lhdc3: