Lineage for d5jisa_ (5jis A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2514799Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2514800Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2515225Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2515226Protein automated matches [190215] (38 species)
    not a true protein
  7. 2515245Species Brucella abortus [TaxId:430066] [332547] (2 PDB entries)
  8. 2515250Domain d5jisa_: 5jis A: [332584]
    automated match to d4airb_

Details for d5jisa_

PDB Entry: 5jis (more details), 2.2 Å

PDB Description: the crystal structure of o-acetyl serine sulfhydralase from brucella abortus
PDB Compounds: (A:) Cysteine synthase

SCOPe Domain Sequences for d5jisa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jisa_ c.79.1.0 (A:) automated matches {Brucella abortus [TaxId: 430066]}
mfnsvldtigntplirlskaseltgcdiygkaeflnpgqsvkdraalyiirdaekrgllr
pggvivegtagntgigltmvakalgyrtaivipetqsqekkdalrllgaelievpaapyr
npnnyvrlsgrlaeqlaktepngaiwanqfdntvnrqahiettaqeiwrdtsdqidgfva
avgsggtlagtaiglkernhnikialadphgaalhafyttgelkaegdsitegigqgrit
anlegftpdfsyqipdaealdilfalveeeglclggssginiagairlakdlgpghtivt
vlcdygnryqsklfnpaflrgkslpvprwle

SCOPe Domain Coordinates for d5jisa_:

Click to download the PDB-style file with coordinates for d5jisa_.
(The format of our PDB-style files is described here.)

Timeline for d5jisa_: