| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) ![]() same topology as (b.1.15.1) |
| Family b.1.30.0: automated matches [254306] (1 protein) not a true family |
| Protein automated matches [254707] (4 species) not a true protein |
| Species Pig (Sus scrofa) [TaxId:9823] [311379] (18 PDB entries) |
| Domain d5ldsc3: 5lds C:545-633 [332581] Other proteins in same PDB: d5ldsa1, d5ldsa2, d5ldsa4, d5ldsb1, d5ldsb2, d5ldsb4, d5ldsc1, d5ldsc2, d5ldsc4, d5ldsd1, d5ldsd2, d5ldsd4 automated match to d4fkha3 complexed with act, nag, zn |
PDB Entry: 5lds (more details), 2 Å
SCOPe Domain Sequences for d5ldsc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ldsc3 b.1.30.0 (C:545-633) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
fpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvsqa
qndlfktasddwvllnvnvtgyfqvnyde
Timeline for d5ldsc3: