Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (20 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [311378] (18 PDB entries) |
Domain d5ldsc2: 5lds C:283-544 [332580] Other proteins in same PDB: d5ldsa1, d5ldsa3, d5ldsa4, d5ldsb1, d5ldsb3, d5ldsb4, d5ldsc1, d5ldsc3, d5ldsc4, d5ldsd1, d5ldsd3, d5ldsd4 automated match to d4fkha2 complexed with act, nag, zn |
PDB Entry: 5lds (more details), 2 Å
SCOPe Domain Sequences for d5ldsc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ldsc2 d.92.1.0 (C:283-544) automated matches {Pig (Sus scrofa) [TaxId: 9823]} qsvnetaqngvliriwarpnaiaeghgmyalnvtgpilnffanhyntsyplpksdqialp dfnagamenwglvtyrenallfdpqsssisnkervvtviahelahqwfgnlvtlawwndl wlnegfasyveylgadhaeptwnlkdlivpgdvyrvmavdalasshplttpaeevntpaq isemfdsisyskgasvirmlsnfltedlfkeglasylhafayqnttyldlwehlqkavda qtsirlpdtvraimdrwtlqmg
Timeline for d5ldsc2: