Lineage for d5ldsc1 (5lds C:62-282)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. Protein automated matches [254706] (5 species)
    not a true protein
  7. Species Pig (Sus scrofa) [TaxId:9823] [311377] (18 PDB entries)
  8. Domain d5ldsc1: 5lds C:62-282 [332579]
    Other proteins in same PDB: d5ldsa2, d5ldsa3, d5ldsa4, d5ldsb2, d5ldsb3, d5ldsb4, d5ldsc2, d5ldsc3, d5ldsc4, d5ldsd2, d5ldsd3, d5ldsd4
    automated match to d4fkha1
    complexed with act, nag, zn

Details for d5ldsc1

PDB Entry: 5lds (more details), 2 Å

PDB Description: structure of the porcine aminopeptidase n ectodomain
PDB Compounds: (C:) Aminopeptidase N

SCOPe Domain Sequences for d5ldsc1:

Sequence, based on SEQRES records: (download)

>d5ldsc1 b.98.1.0 (C:62-282) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
dqskpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrficqeptdviiihsk
klnyttqghmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgel
addlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltal
snmppkgsstplaedpnwsvtefettpvmstyllayivsef

Sequence, based on observed residues (ATOM records): (download)

>d5ldsc1 b.98.1.0 (C:62-282) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
dqskpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrficqeptdviiihsk
klnythmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgeladd
lagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltalsnm
ppkgsstplaedpnwsvtefettpvmstyllayivsef

SCOPe Domain Coordinates for d5ldsc1 are not available.

Timeline for d5ldsc1:

Domains from same chain:
(mouse over for more information)
d5ldsc2, d5ldsc3, d5ldsc4
Domains from other chains:
(mouse over for more information)
d5ldsa1, d5ldsa2, d5ldsa3, d5ldsa4, d5ldsb1, d5ldsb2, d5ldsb3, d5ldsb4, d5ldsd1, d5ldsd2, d5ldsd3, d5ldsd4