Lineage for d5ldsd4 (5lds D:634-963)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2726072Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2726073Protein automated matches [190220] (14 species)
    not a true protein
  7. 2726215Species Pig (Sus scrofa) [TaxId:9823] [311380] (18 PDB entries)
  8. 2726225Domain d5ldsd4: 5lds D:634-963 [332576]
    Other proteins in same PDB: d5ldsa1, d5ldsa2, d5ldsa3, d5ldsb1, d5ldsb2, d5ldsb3, d5ldsc1, d5ldsc2, d5ldsc3, d5ldsd1, d5ldsd2, d5ldsd3
    automated match to d4fkha4
    complexed with act, nag, zn

Details for d5ldsd4

PDB Entry: 5lds (more details), 2 Å

PDB Description: structure of the porcine aminopeptidase n ectodomain
PDB Compounds: (D:) Aminopeptidase N

SCOPe Domain Sequences for d5ldsd4:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ldsd4 a.118.1.0 (D:634-963) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
dnwrmiqhqlqtnlsvipvinraqviydsfnlatahmvpvtlaldntlflngekeympwq
aalsslsyfslmfdrsevygpmkkylrkqveplfqhfetltknwterpenlmdqyseina
istacsnglpqcenlaktlfdqwmsdpennpihpnlrstiycnaiaqggqdqwdfawgql
qqaqlvneadklrsalacsnevwllnrylgytlnpdlirkqdatstinsiasnvigqpla
wdfvqsnwkklfqdygggsfsfsnliqgvtrrfssefelqqleqfkknnmdvgfgsgtra
leqalektkanikwvkenkevvlnwfiehs

SCOPe Domain Coordinates for d5ldsd4:

Click to download the PDB-style file with coordinates for d5ldsd4.
(The format of our PDB-style files is described here.)

Timeline for d5ldsd4: