Lineage for d5ldsd3 (5lds D:545-633)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. Protein automated matches [254707] (4 species)
    not a true protein
  7. Species Pig (Sus scrofa) [TaxId:9823] [311379] (18 PDB entries)
  8. Domain d5ldsd3: 5lds D:545-633 [332575]
    Other proteins in same PDB: d5ldsa1, d5ldsa2, d5ldsa4, d5ldsb1, d5ldsb2, d5ldsb4, d5ldsc1, d5ldsc2, d5ldsc4, d5ldsd1, d5ldsd2, d5ldsd4
    automated match to d4fkha3
    complexed with act, nag, zn

Details for d5ldsd3

PDB Entry: 5lds (more details), 2 Å

PDB Description: structure of the porcine aminopeptidase n ectodomain
PDB Compounds: (D:) Aminopeptidase N

SCOPe Domain Sequences for d5ldsd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ldsd3 b.1.30.0 (D:545-633) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
fpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvsqa
qndlfktasddwvllnvnvtgyfqvnyde

SCOPe Domain Coordinates for d5ldsd3 are not available.

Timeline for d5ldsd3:

Domains from same chain:
(mouse over for more information)
d5ldsd1, d5ldsd2, d5ldsd4
Domains from other chains:
(mouse over for more information)
d5ldsa1, d5ldsa2, d5ldsa3, d5ldsa4, d5ldsb1, d5ldsb2, d5ldsb3, d5ldsb4, d5ldsc1, d5ldsc2, d5ldsc3, d5ldsc4