Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) same topology as (b.1.15.1) |
Family b.1.30.0: automated matches [254306] (1 protein) not a true family |
Protein automated matches [254707] (4 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [311379] (18 PDB entries) |
Domain d5ldsd3: 5lds D:545-633 [332575] Other proteins in same PDB: d5ldsa1, d5ldsa2, d5ldsa4, d5ldsb1, d5ldsb2, d5ldsb4, d5ldsc1, d5ldsc2, d5ldsc4, d5ldsd1, d5ldsd2, d5ldsd4 automated match to d4fkha3 complexed with act, nag, zn |
PDB Entry: 5lds (more details), 2 Å
SCOPe Domain Sequences for d5ldsd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ldsd3 b.1.30.0 (D:545-633) automated matches {Pig (Sus scrofa) [TaxId: 9823]} fpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvsqa qndlfktasddwvllnvnvtgyfqvnyde
Timeline for d5ldsd3: